PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30055.m001589
Common NameLOC8271947, RCOM_1281990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB
Protein Properties Length: 214aa    MW: 24281 Da    PI: 7.9701
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30055.m001589genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.2e-09954346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +W+  Ed+l+ +a   ++ +   +W++Ia++++ g+++ ++k+++ +
    30055.m001589  9 SWSRLEDKLFERALVVFPEEtpdRWEKIASHVP-GKSRFDVKEHYED 54
                     7*****************99*************.***********76 PP

2Myb_DNA-binding43.29.4e-14109153347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
    30055.m001589 109 PWTEEEHRLFLIGLQRYGKGDWRSISRNAVVSRTPTQVASHAQKY 153
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.055560IPR017884SANT domain
SMARTSM007178.6E-9658IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-11656IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-5855IPR009057Homeodomain-like
PfamPF002495.6E-8955IPR001005SANT/Myb domain
CDDcd001679.33E-8956No hitNo description
PROSITE profilePS5129418.513102158IPR017930Myb domain
SuperFamilySSF466894.56E-17104159IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-17106156IPR006447Myb domain, plants
SMARTSM007178.1E-10106156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-12106152IPR009057Homeodomain-like
CDDcd001674.00E-9109154No hitNo description
PfamPF002492.3E-11109153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MIGASPSSSW SRLEDKLFER ALVVFPEETP DRWEKIASHV PGKSRFDVKE HYEDLVYDVK  60
EIDSGRVELP SYGDQFGLGW GAAESGTSQV WFGSKGKEKE TSERRKGVPW TEEEHRLFLI  120
GLQRYGKGDW RSISRNAVVS RTPTQVASHA QKYFLRLNSV KKEKKRPSIH DITTSANSVP  180
PQSNDHNWAD YMDPKPYPDH GSPSSAFHGF GFPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1510721173RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159166VKKEKKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002523835.11e-158PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9SCW61e-158B9SCW6_RICCO; DNA binding protein, putative
STRINGVIT_06s0080g00790.t017e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.15e-71MYB family protein